Recombinant E. coli β-Glucuronidase/β-GUS/GUSB (N-6His)

Eton Bio Recombinant E.coli beta-Glucuronidase is produced by our E.coli expression system and the target gene encoding Met1-Gln603 is expressed with a 6His tag at the N-terminus.

Sku #Product NameProduct SizePriceQTY
3713030010 Recombinant E. coli β-Glucuronidase/β-GUS/GUSB (N-6His) 10μg 10μg $165.00 USD
3713030501 Recombinant E. coli β-Glucuronidase/β-GUS/GUSB (N-6His) 50μg 50μg $375.00 USD
3713035001 Recombinant E. coli β-Glucuronidase/β-GUS/GUSB (N-6His) 500μg 500μg $1600.00 USD
3713030012 Recombinant E. coli β-Glucuronidase/β-GUS/GUSB (N-6His) 1mg 1mg $2260.00 USD
 

Add to Cart

Beta-D-glucuronidase from E.coli is a highly specific enzyme in hydrolyzing glucuronides. Beta-D-glucuronidase (GLUase) activity can be measured as the rate of production of fluorescent methylumbelliferone (MU), resulting from the hydrolysis of the substrate 4-methylumbelliferyl-β-d-glucuronide (MUGLU), which is an effective and rapid method for detection and verification of E. coli in food, water, and environmental samples. High purity recombinant beta-Glucuronidase is used in research, biochemical enzyme assays and in vitro diagnostic analysis, detecting a wide range of drugs such as opioids, benzodiazepines, steroids, cannabinoids, and others.

Source

E.coli

Description

Recombinant E.coli beta-Glucuronidase is produced by our E.coli expression system and the target gene encoding Met1-Gln603 is expressed with a 6His tag at the N-terminus.

Names

Beta-glucuronidase,uidA,GUS

Accession #

P05804

Formulation

Supplied as a 0.2 μm filtered solution of PBS,pH7.4.

Shipping

The product is shipped on dry ice/ice packs.

Storage

Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Amino Acid Sequence

MNHKVHHHHHHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQ FADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVT PYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWV DDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYL YELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHD HALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIGFEAGNKPKELYSEEA VNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCV NVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDT LAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRD RKPKSAAFLLQKRWTGMNFGEKPQQGGKQ

Copyright © 2003-2018

All Rights Reserved

Eton Bioscience, Inc.
5820 Oberlin Drive, Suite 108
San Diego, CA 92121
DNA Sequencing
Specialty DNA Sequencing
Direct Sequencing
Genomic Services
Fragment Analysis
Mammilian Cell Expression
Peptide Synthesis
Antibody Services
DNA Prep Service
Facebook LinkedIn Google Plus Twitter