Recombinant E. coli Tryptophan Synthase α Chain/Trp A

Eton Bio Recombinant E.coli Tryptophan synthase alpha chain is produced by our E.coli expression system and the target gene encoding Met1-Ser268 is expressed.

Sku #Product NameProduct SizePriceQTY
3713010010 Recombinant E. coli Tryptophan Synthase α Chain/Trp A 10μg 10μg $165.00 USD
3713010501 Recombinant E. coli Tryptophan Synthase α Chain/Trp A 50μg 50μg $375.00 USD
3713015001 Recombinant E. coli Tryptophan Synthase α Chain/Trp A 500μg 500μg $1600.00 USD
3713010012 Recombinant E. coli Tryptophan Synthase α Chain/Trp A 1mg 1mg $2260.00 USD
 

Add to Cart

Tryptophan synthase is an enzyme that catalyzes the final two steps in the biosynthesis of tryptophan. It is commonly found in Eubacteria, Archaebacteria, Protista, Fungi, and Plantae, but is absent from animals such as humans. Tryptophan synthase typically exists as an α-ββ-α complex.The alpha subunit is responsible for the aldol cleavage of indoleglycerol phosphate to indole and glyceraldehyde 3-phosphate: L-serine + 1-C-(indol-3-yl)glycerol 3-phosphate = L-tryptophan + D-glyceraldehyde 3-phosphate + H2O.The beta subunits catalyze the irreversible condensation of indole and serine to form tryptophan in a pyridoxal phosphate (PLP) dependent reaction. Their assembly into a complex leads to structural changes in both subunits resulting in reciprocal activation

Source

E.coli

Description

Recombinant E.coli Tryptophan synthase alpha chain is produced by our E.coli expression system and the target gene encoding Met1-Ser268 is expressed.

Names

Tryptophan synthase alpha chain, trpA

Accession #

P0A877

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.

Shipping

The product is shipped at ambient temperature.

Reconstitution

Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Storage

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Amino Acid Sequence

MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQ NATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVAD VPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNH LVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQ PMKAATRS

Copyright © 2003-2018

All Rights Reserved

Eton Bioscience, Inc.
5820 Oberlin Drive, Suite 108
San Diego, CA 92121
DNA Sequencing
Specialty DNA Sequencing
Direct Sequencing
Genomic Services
Fragment Analysis
Mammilian Cell Expression
Peptide Synthesis
Antibody Services
DNA Prep Service
Facebook LinkedIn Google Plus Twitter