Recombinant E. coli RNA Pyrophosphohydrolase/rppH

Eton Bio Recombinant E.coli RNA pyrophosphohydrolase is produced by our E.coli expression system and the target gene encoding Met1-Gly176 is expressed

Sku #Product NameProduct SizePriceQTY
3712990010 Recombinant E. coli RNA Pyrophosphohydrolase/rppH 10μg 10μg $165.00 USD
3712990501 Recombinant E. coli RNA Pyrophosphohydrolase/rppH 50μg 50μg $375.00 USD
3712995001 Recombinant E. coli RNA Pyrophosphohydrolase/rppH 500μg 500μg $1600.00 USD
3712990012 Recombinant E. coli RNA Pyrophosphohydrolase/rppH 1mg 1mg $2260.00 USD
 

Add to Cart

Messenger RNA (mRNA) degradation plays a key role in the control of gene expression in all organisms by limiting the number of times that each mRNA molecule can be used as a template for protein synthesis. RNA pyrophosphohydrolase, also called RppH, is a master regulator of 5'-dependent mRNA decay. It accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage. RppH preferentially hydrolyzes diadenosine penta-phosphate with ATP as one of the reaction products, and can be able to hydrolyze diadenosine hexa- and tetra-phosphate. However, this protein has no activity on diadenosine tri-phosphate, ADP-ribose, NADH and UDP-glucose. In the meningitis causing strain E.coli K1, it has been shown to play a role in HBMEC (human brain microvascular endothelial cells) invasion in vitro.

Source

E.coli

Description

Recombinant E.coli RNA pyrophosphohydrolase is produced by our E.coli expression system and the target gene encoding Met1-Gly176 is expressed.

Names

RNA pyrophosphohydrolase, (Di)nucleoside polyphosphate hydrolase, Ap5A pyrophosphatase, rppH

Accession #

P0A776

Formulation

Supplied as a 0.2 μm filtered solution of 50mM Tris, 500mM NaCl, 10% glycerol, pH8.0.

Shipping

The product is shipped on dry ice/ice packs.

Storage

Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Amino Acid Sequence
MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDV RILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYW YPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

Copyright © 2003-2018

All Rights Reserved

Eton Bioscience, Inc.
5820 Oberlin Drive, Suite 108
San Diego, CA 92121
DNA Sequencing
Specialty DNA Sequencing
Direct Sequencing
Genomic Services
Fragment Analysis
Mammilian Cell Expression
Peptide Synthesis
Antibody Services
DNA Prep Service
Facebook LinkedIn Google Plus Twitter