Recombinant E. coli N-Acetyl-D-Glucosamine Kinase/NAGK (C-6His)

Eton Bio Recombinant E.coli NAGK is produced by our E.coli expression system and the target gene encoding Met1-Asp303 is expressed with a 6His tag at the C-terminus.

Sku #Product NameProduct SizePriceQTY
3712980010 Recombinant E. coli N-Acetyl-D-Glucosamine Kinase/NAGK (C-6His) 10μg 10μg $165.00 USD
3712980501 Recombinant E. coli N-Acetyl-D-Glucosamine Kinase/NAGK (C-6His) 50μg 50μg $375.00 USD
3712985001 Recombinant E. coli N-Acetyl-D-Glucosamine Kinase/NAGK (C-6His) 500μg 500μg $1600.00 USD
3712980012 Recombinant E. coli N-Acetyl-D-Glucosamine Kinase/NAGK (C-6His) 1mg 1mg $2260.00 USD
 

Add to Cart

N-Acetyl-D-Glucosamine Kinase (NAGK) belongs to the Eukaryotic-Type N-Acetylhexosamine Kinases family. NAGK is a homodimer and expressed in many tissues. NAGK is a prominent salvage enzyme of amino sugar metabolism in mammals. It is a major component of complex carbohydrates and converts GlcNAc into GlcNAc 6-phosphate from lysosomal degradation or nutritional sources. In addition, NAGK has ManNAc kinase activity.

Source E.coli

Description

Recombinant E.coli NAGK is produced by our E.coli expression system and the target gene encoding Met1-Asp303 is expressed with a 6His tag at the C-terminus.

Names

N-Acetyl-D-Glucosamine Kinase, N-Acetylglucosamine Kinase, GlcNAc Kinase, NAGK

Accession #

P75959

Formulation

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl,2mM DTT,20% Glycerol, pH 8.0.

Shipping

The product is shipped on dry ice/ice packs.

Storage

Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Amino Acid Sequence
MNHKVHHHHHHMYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADQRF GCKGSVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF TQYPLVMGLILGTGVGGGLIFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGCGQHGC IENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLV VIGGGLSNFPAITTQLADRLPRHLLPVARVPRIERARHGDAGGMRGAAFLHLTD

Copyright © 2003-2018

All Rights Reserved

Eton Bioscience, Inc.
5820 Oberlin Drive, Suite 108
San Diego, CA 92121
DNA Sequencing
Specialty DNA Sequencing
Direct Sequencing
Genomic Services
Fragment Analysis
Mammilian Cell Expression
Peptide Synthesis
Antibody Services
DNA Prep Service
Facebook LinkedIn Google Plus Twitter