Recombinant E. coli Malate Dehydrogenase/MDH (N-6His)

Recombinant E.coli Malate Dehydrogenase is produced by our E.coli expression system and the target gene encoding Met1-Lys312 is expressed with a 6His tag at the N-terminus.

Sku #Product NameProduct SizePriceQTY
3712970010 Recombinant E. coli Malate Dehydrogenase/MDH (N-6His) 10μg 10μg $210.00 USD
3712970501 Recombinant E. coli Malate Dehydrogenase/MDH (N-6His) 50μg 50μg $500.00 USD
3712975001 Recombinant E. coli Malate Dehydrogenase/MDH (N-6His) 500μg 500μg $1600.00 USD
3712970012 Recombinant E. coli Malate Dehydrogenase/MDH (N-6His) 1mg 1mg $2460.00 USD
 

Add to Cart

Escherichia coli MDH, also known as Malate dehydrogenase, is a group of multimeric enzymes consisting of identical subunits usually organized as either dimer or tetramers with subunit molecular weights of 30-35 kDa. Its major function is to catalyze the NAD / NADH-dependent interconversion of the substrates malate and oxaloacetate. This reaction plays a key part in the malate / aspartate shuttle across the mitochondrial membrane, and in the tricarboxylic acid cycle within the mitochondrial matrix.MDH is synthesized in several organisms including archaea, eubacteria, fungi, plant and mammals. The enzymes share a common catalytic mechanism and their kinetic properties are similar, which demonstrates a high degree of structural similarity. The three-dimensional structures and elements essential for catalysis are conserved between mitochondrial and cytoplasmic forms of MDH in eukaryotic cells even though these isoenzymes are only marginally related at the level of primary structure.

Source

E.coli

Description

Recombinant E.coli Malate Dehydrogenase is produced by our E.coli expression system and the target gene encoding Met1-Lys312 is expressed with a 6His tag at the N-terminus.

Names

Malate dehydrogenase,mdh

Accession #

P61889

Formulation

Supplied as a 0.2 μm filtered solution of 50mM PB,50%Glycerol,pH7.5.

Shipping

The product is shipped on dry ice/ice packs.

Storage

Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Amino Acid Sequence
MGSSHHHHHHSSGLVPRGSHMKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVD LSHIPTAVKIKGFSGEDATPALEGADVVLISAGVRRKPGMDRSDLFNVNAGIVKNLVQQVAKTCP KACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLLGVTTLDIIRSNTFVAELKGKQPGEVEVPVIG GHSGVTILPLLSQVPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVR ALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTLKKDIAL GQEFVNK

Copyright © 2003-2018

All Rights Reserved

Eton Bioscience, Inc.
5820 Oberlin Drive, Suite 108
San Diego, CA 92121
DNA Sequencing
Specialty DNA Sequencing
Direct Sequencing
Genomic Services
Fragment Analysis
Mammilian Cell Expression
Peptide Synthesis
Antibody Services
DNA Prep Service
Facebook LinkedIn Google Plus Twitter