Recombinant Dechloromonas aromatica (Strain RCB) Chlorite Dismutase (N-6His)

Eton Bio Recombinant Dechloromonas aromatica (strain RCB) Chlorite dismutase Chlorite dismutase is produced by our E.coli expression system and the target gene encoding Met35-Asp282 is expressed with a 6His tag at the N-terminus.

Sku #Product NameProduct SizePriceQTY
3712960010 Recombinant Dechloromonas aromatica (Strain RCB) Chlorite Dismutase (N-6His) 10μg 10μg $165.00 USD
3712960501 Recombinant Dechloromonas aromatica (Strain RCB) Chlorite Dismutase (N-6His) 50μg 50μg $375.00 USD
3712965001 Recombinant Dechloromonas aromatica (Strain RCB) Chlorite Dismutase (N-6His) 500μg 500μg $1600.00 USD
3712960012 Recombinant Dechloromonas aromatica (Strain RCB) Chlorite Dismutase (N-6His) 1mg 1mg $2260.00 USD
 

Add to Cart

Chlorite dismutase (Cld) found in prokaryotic organisms, also known as Chlorite O2-lyase, is a b-type heme containing enzyme that catalyzes the reduction of chlorite into chloride plus dioxygen. The subunit of chlorite dismutase consists of a heme free N-terminal and a heme b containing C-terminal ferredoxin-like fold with high structural homology to the dye-decolorizing peroxidases (DyPs). The physiological role of Cld in prokaryote has been shown that some microorganisms can use perchlorate or chlorate as terminal electron acceptors for anaerobic respiration thereby producing chlorite that must be detoxified. This enzyme has gained attention because it can be used in the development of bioremediation processes, biosensors, and controlled dioxygen production.

Source

E.coli

Description

Recombinant Dechloromonas aromatica (strain RCB) Chlorite dismutase Chlorite dismutase is produced by our E.coli expression system and the target gene encoding Met35-Asp282 is expressed with a 6His tag at the N-terminus.

Names

Chlorite dismutase, Chlorite O(2)-lyase, Daro_2580, Cld

Accession #

Q47CX0

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 0.5mM EDTA, pH7.4.

Shipping

The product is shipped at ambient temperature.

Reconstitution

Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Storage

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Amino Acid Sequence
MGSSHHHHHHSSGLVPRGSHMENLYFQGMQPMQSMKIERGTILTQPGVFGVFTMFKLRPDWNKVP VAERKGAAEEVKKLIEKHKDNVLVDLYLTRGLETNSDFFFRINAYDLAKAQTFMREFRSTTVGKN ADVFETLVGVTKPLNYISKDKSPGLNAGLSSATYSGPAPRYVIVIPVKKNAEWWNMSPEERLKEM EVHTTPTLAYLVNVKRKLYHSTGLDDTDFITYFETDDLTAFNNLMLSLAQVKENKFHVRWGSPTT LGTIHSPEDVIKALAD

Copyright © 2003-2018

All Rights Reserved

Eton Bioscience, Inc.
5820 Oberlin Drive, Suite 108
San Diego, CA 92121
DNA Sequencing
Specialty DNA Sequencing
Direct Sequencing
Genomic Services
Fragment Analysis
Mammilian Cell Expression
Peptide Synthesis
Antibody Services
DNA Prep Service
Facebook LinkedIn Google Plus Twitter