Recombinant Cynomolgus TIGIT/VSIG9/VSTM3 (C-6His)

Eton Bio Recombinant Cynomolgus monkey TIGIT is produced by our Mammalian expression system and the target gene encoding Met89-Pro209 is expressed with a 6His tag at the C-terminus.

Sku #Product NameProduct SizePriceQTY
3712950010 Recombinant Cynomolgus TIGIT/VSIG9/VSTM3 (C-6His) 10μg 10μg $155.00 USD
3712950501 Recombinant Cynomolgus TIGIT/VSIG9/VSTM3 (C-6His) 50μg 50μg $310.00 USD
3712955001 Recombinant Cynomolgus TIGIT/VSIG9/VSTM3 (C-6His) 500μg 500μg $1600.00 USD
3712950012 Recombinant Cynomolgus TIGIT/VSIG9/VSTM3 (C-6His) 1mg 1mg $2260.00 USD
 

Add to Cart

T cell immunoreceptor with Ig and ITIM domains (TIGIT), also called VSIG9 and Vstm3, is a member of the CD28 family within the Ig superfamily of proteins. TIGIT contains an immunoglobulin variable domain, a transmembrane domain and an immunoreceptor tyrosine-based inhibitory motif (ITIM), and is expressed on regulatory, memory, activated T cells and NK cells. TIGIT binds to CD155(PVR) that appear on dendritic cells (DC), macrophages and endothelium with high affinity, and CD112(PVRL2) with lower affinity, but not CD113 (PVRL3). TIGIT-Fc fusion protein could interact with PVR on DC and enhance the secretion of IL-10, but inhibit the macrophage activation. Mice lacking TIGIT show increased T cell responses and susceptibility to autoimmune challenges, while knockdown of TIGIT with siRNA in human memory T cells did not affect T cell responses.

Source

Human Cells

Description

Recombinant Cynomolgus monkey TIGIT is produced by our Mammalian expression system and the target gene encoding Met89-Pro209 is expressed with a 6His tag at the C-terminus.

Names

T-cell immunoreceptor with Ig and ITIM domains, VSIG9, VSTM3, TIGIT, V-set and transmembrane domain-containing protein 3, V-set and immunoglobulin domain-containing protein 9

Accession #

G7NXM4

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping

The product is shipped at ambient temperature.

Reconstitution

Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Storage

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Amino Acid Sequence
MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRV APGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIPHHHHHH

Copyright © 2003-2018

All Rights Reserved

Eton Bioscience, Inc.
5820 Oberlin Drive, Suite 108
San Diego, CA 92121
DNA Sequencing
Specialty DNA Sequencing
Direct Sequencing
Genomic Services
Fragment Analysis
Mammilian Cell Expression
Peptide Synthesis
Antibody Services
DNA Prep Service
Facebook LinkedIn Google Plus Twitter