Recombinant Cynomolgus PDCD1/PD-1/CD279

Eton Bio Recombinant Cynomolgus monkey Programmed Cell Death Protein 1 is produced by our Mammalian expression system and the target gene encoding Pro21-Gln167 is expressed with a 6His tag at the C-terminus.

Sku #Product NameProduct SizePriceQTY
3712940010 Recombinant Cynomolgus PDCD1/PD-1/CD279 10μg 10μg $155.00 USD
3712940501 Recombinant Cynomolgus PDCD1/PD-1/CD279 50μg 50μg $310.00 USD
3712945001 Recombinant Cynomolgus PDCD1/PD-1/CD279 500μg 500μg $1600.00 USD
3712940012 Recombinant Cynomolgus PDCD1/PD-1/CD279 1mg 1mg $2260.00 USD
 

Add to Cart

Programmed cell death protein 1(PDCD1) is a single-pass type I membrane protein and contains 1 Ig-like V-type domain. PD-1 is a member of the extended CD28/CTLA-4 family of T cell regulators. PDCD1 inhibits the T-cell proliferation and production of related cytokines including IL-1, IL-4, IL-10 and IFN-γ by suppressing the activation and transduction of PI3K/AKT pathway. In addition, coligation of PDCD1 inhibits BCR-mediating signal by dephosphorylating key signal transducer. PDCD1 has been suggested to be involved in lymphocyte clonal selection and peripheral tolerance, and thus contributes to the prevention of autoimmune diseases. As a cell surface molecule, PDCD1 regulates the adaptive immune response. Engagement of PD-1 by its ligands PD-L1 or PD-L2 transduces a signal that inhibits T-cell proliferation, cytokine production, and cytolytic function.Enter the section text here

Source

Human Cells

Description

Recombinant Cynomolgus monkey Programmed Cell Death Protein 1 is produced by our Mammalian expression system and the target gene encoding Pro21-Gln167 is expressed with a 6His tag at the C-terminus.

Names

Programmed cell death 1, PD-1, PD1

Accession #

B0LAJ3

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping

The product is shipped at ambient temperature.

Reconstitution

Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Storage

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Amino Acid Sequence
PGWFLESPDRPWNAPTFSPALLLVTEGDNATFTCSFSNASESFVLNWYRMSPSNQTDKLAAFPED RSQPGQDCRFRVTRLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE VPTAHPSPSPRPAGQFQHHHHHH

Copyright © 2003-2018

All Rights Reserved

Eton Bioscience, Inc.
5820 Oberlin Drive, Suite 108
San Diego, CA 92121
DNA Sequencing
Specialty DNA Sequencing
Direct Sequencing
Genomic Services
Fragment Analysis
Mammilian Cell Expression
Peptide Synthesis
Antibody Services
DNA Prep Service
Facebook LinkedIn Google Plus Twitter