Recombinant E.coli LacI

Eton Bio Recombinant E.coli Lactose operon repressor/LacI is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Gln360) of E.coli LacI fused with a 6His tag at the C-terminus.

Sku #Product NameProduct SizePriceQTY
3709790101 Recombinant E.coli LacI 10μg 10μg $210.00 USD
3709790501 Recombinant E.coli LacI 50μg 50μg $500.00 USD
3709795001 Recombinant E.coli LacI 500μg 500μg $1740.00 USD
3709790012 Recombinant E.coli LacI 1mg 1mg $2460.00 USD
 

Add to Cart

Lactose operon repressor (LacI) contains one HTH lacI-type DNA-binding domain, functions as a homotetramer. Lactose operon repressor as a repressor of the lactose operon, which also as an inducer, binds allolactose. If remove residues 1-59, resulting the loss of DNA-binding activity but retains tetrameric structure and inducer-binding activity. If delete residues 340-360, resulting the loss of tetramer formation, but retains dimer formation, inducer-binding activity, and DNA-binding activity.

Source E.coli
Names Lactose operon repressor, LacI
Accession # P03023
Formulation Supplied as a 0.2 μM filtered solution of 20mM Tris, 300mM NaCl, 5mM DTT pH 8.0
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg).
Amino Acid Sequence
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIG VATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDD QDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSAR LRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITES GLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVK RKTTLAPNTQTASPRALADSLMQLARQVSRLESGQHHHHHH


Copyright © 2003-2018

All Rights Reserved

Eton Bioscience, Inc.
5820 Oberlin Drive, Suite 108
San Diego, CA 92121
DNA Sequencing
Specialty DNA Sequencing
Direct Sequencing
Genomic Services
Fragment Analysis
Mammilian Cell Expression
Peptide Synthesis
Antibody Services
DNA Prep Service
Facebook LinkedIn Google Plus Twitter