Recombinant Mouse SERPIN F1

Eton Bio Recombinant Mouse Pigment epithelium-derived factor/SERPIN F1 is produced with our E. coli expression system. The target protein is expressed with sequence (Asp43?Thr417 ) of Mouse SERPIN F1.

Sku #Product NameProduct SizePriceQTY
3708980101 Recombinant Mouse SERPIN F1 10μg 10μg $155.00 USD
3708980501 Recombinant Mouse SERPIN F1 50μg 50μg $345.00 USD
3708985001 Recombinant Mouse SERPIN F1 500μg 500μg $1600.00 USD
3708980012 Recombinant Mouse SERPIN F1 1mg 1mg $2260.00 USD
 

Add to Cart

Serpin F1 is secreted Neurotrophic protein and belongs to the serpin family. Serpin F1 Highly expressed in the liver, gastric glandular mucosa and renal tubules. It is also expressed in the brain, heart, lung retina and testes. It induces extensive neuronal differentiation in retinoblastoma cells. It is potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, exhibits no serine protease inhibitory activity.

Source E.coli
Names Pigment epithelium-derived factor, Pedf, Sdf3, Caspin, Serpin F1, Stromal cell-derived factor 3.
Accession # P97298
Formulation Lyophilized from a 0.2 μM filtered solution of PBS, pH 7.4
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 3X PBS.
Please aliquot the reconstituted solution
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 5 months.
Purity Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg).
Amino Acid Sequence
MDPFFKVPVNKLAAAVSNFGYDLYRLRSSASPTGNVLLSPLSVATALSALSLGAEHRTESVIHRA LYYDLITNPDIHSTYKELLASVTAPEKNLKSASRIVFERKLRVKSSFVAPLEKSYGTRPRILTGN PRVDLQEINNWVQAQMKGKIARSTREMPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLDEDR TVRVPMMSDPKAILRYGLDSDLNCKIAQLPLTGSMSIIFFLPLTVTQNLTMIEESLTSEFIHDID RELKTIQAVLTVPKLKLSFEGELTKSLQDMKLQSLFESPDFSKITGKPVKLTQVEHRAAFEWNEE GAGSSPSPGLQPVRLTFPLDYHLNQPFLFVLRDTDTGALLFIGRILDPSST


Copyright © 2003-2018

All Rights Reserved

Eton Bioscience, Inc.
5820 Oberlin Drive, Suite 108
San Diego, CA 92121
DNA Sequencing
Specialty DNA Sequencing
Direct Sequencing
Genomic Services
Fragment Analysis
Mammilian Cell Expression
Peptide Synthesis
Antibody Services
DNA Prep Service
Facebook LinkedIn Google Plus Twitter