Recombinant FIBP

Eton Bio Recombinant Human Acidic Fibroblast Growth Factor Intracellular-Binding Protein/FIBP is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Asp357) of Human FIBP.

Sku #Product NameProduct SizePriceQTY
3707730101 Recombinant FIBP 10μg 10μg $210.00 USD
3707730501 Recombinant FIBP 50μg 50μg $500.00 USD
3707735001 Recombinant FIBP 500μg 500μg $1740.00 USD
3707730012 Recombinant FIBP 1mg 1mg $2460.00 USD
 

Add to Cart

Acidic Fibroblast Growth Factor Intracellular-Binding Protein (FIBP) is highly expressed in the heart, skeletal muscle, and pancreas. Acidic Fibroblast Growth Factor is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FIBP is an intracellular protein that binds selectively to acidic fibroblast growth factor (aFGF). It is postulated that FIBP may be involved in the mitogenic action of aFGF.

Source E. coli
Names Acidic Fibroblast Growth Factor Intracellular-Binding Protein, aFGF Intracellular-Binding Protein, FGF-1 Intracellular-Binding Protein, FIBP
Accession # O43427
Formulation Supplied as a 0.2 μM filtered solution of 50mM Tris, pH 8.0
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
AMADIGSMTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMD HYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDI STKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGK KKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSL VCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVR FFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD

Copyright © 2003-2018

All Rights Reserved

Eton Bioscience, Inc.
5820 Oberlin Drive, Suite 108
San Diego, CA 92121
DNA Sequencing
Specialty DNA Sequencing
Direct Sequencing
Genomic Services
Fragment Analysis
Mammilian Cell Expression
Peptide Synthesis
Antibody Services
DNA Prep Service
Facebook LinkedIn Google Plus Twitter