Recombinant HEK293 SOST

Eton Bio Recombinant Human Sclerostin is produced by our mammalian expression system. The target protein is expressed with sequence (Gln24-Tyr213) of Human SOST with a polyhistidine tag at the C-terminus.

Sku #Product NameProduct SizePriceQTY
3707270101 Recombinant HEK293 SOST 10μg 10μg $210.00 USD
3707270501 Recombinant HEK293 SOST 50μg 50μg $500.00 USD
3707275001 Recombinant HEK293 SOST 500μg 500μg $1740.00 USD
3707270012 Recombinant HEK293 SOST 1mg 1mg $2460.00 USD
 

Add to Cart

Sclerostin, also known as SOST, is a member of the Cerberus/DAN family of BMP antagonists. SOST is a secreted glycoprotein with a C-terminal cysteine knot-like (CTCK) domain. It shows sequence similarity to the DAN (differential screening-selected gene aberrative in neuroblastoma) family of bone morphogenetic protein (BMP) antagonists. SOST is produced by the osteocyte and has anti-anabolic effects on bone formation. It is a negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.

Source HEK293
Names SOST, UNQ2976, PRO7455, PRO7476
Accession # Q9BQB4
Formulation Supplied as a 0.2 μM filtered solution of 20mM Tris, 250mM NaCl, pH 8.0
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg).
Amino Acid Sequence
QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRY VTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEA PRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAYHHHHH H

Copyright © 2003-2018

All Rights Reserved

Eton Bioscience, Inc.
5820 Oberlin Drive, Suite 108
San Diego, CA 92121
DNA Sequencing
Specialty DNA Sequencing
Direct Sequencing
Genomic Services
Fragment Analysis
Mammilian Cell Expression
Peptide Synthesis
Antibody Services
DNA Prep Service
Facebook LinkedIn Google Plus Twitter