Recombinant e.coli Fpg

Eton Bio Recombinant E. coli Formamidopyrimidine-DNA Glycosylase/Fpg is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Lys269) of E. coli Fpg.

Sku #Product NameProduct SizePriceQTY
3705970101 Recombinant e.coli Fpg 10μg 10μg $165.00 USD
3705970501 Recombinant e.coli Fpg 50μg 50μg $375.00 USD
3705975001 Recombinant e.coli Fpg 500µg 500µg $1600.00 USD
3705970012 Recombinant e.coli Fpg 1mg 1mg $2260.00 USD
 

Add to Cart

Fpg is a DNA glycosylase that releases damaged bases preferentially from duplex DNA. It has an associated class I AP (apurinic/apyrimidinic) lyase activity.Fpg Cleaves the DNA backbone to generate a single-strand break at the site of the removed base, The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving 3' and 5' phosphoryl groups.

Source E. coli
Names Formamidopyrimidine-DNA Glycosylase, Fapy-DNA Glycosylase, DNA-(Apurinic or Apyrimidinic Site) Lyase MutM, AP Lyase MutM, mutM, fpg
Accession # A7ZTI6
Formulation Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM EDTA, 1mM DTT, 50% Glycerol, pH 7.8
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
MPELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYRLSDQPVLSVQRRAKYLLLELPE GWIIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKELEGHNVLTHLG PEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAEC ELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRA TFYCRQCQKLEHHHHHH

Copyright © 2003-2018

All Rights Reserved

Eton Bioscience, Inc.
5820 Oberlin Drive, Suite 108
San Diego, CA 92121
DNA Sequencing
Specialty DNA Sequencing
Direct Sequencing
Genomic Services
Fragment Analysis
Mammilian Cell Expression
Peptide Synthesis
Antibody Services
DNA Prep Service
Facebook LinkedIn Google Plus Twitter