Recombinant E.coli MAP

Eton Bio Recombinant E. coli Methionine Aminopeptidase/MAP is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Glu264) of E.coli MAP.

Sku #Product NameProduct SizePriceQTY
3703330101 Recombinant E.coli MAP 10µg 10µg $177.00 USD
3703330501 Recombinant E.coli MAP 50µg 50µg $410.00 USD
3703335001 Recombinant E.coli MAP 500μg 500μg $1600.00 USD
3703330012 Recombinant E.coli MAP 1mg 1mg $2260.00 USD
 

Add to Cart

Methionine aminopeptidase 1, METAP, also named MAP 1, MetAP 1, Peptidase M 1, is a member of the M24 family of metalloproteases. METAPs play a central role for protein maturation as they remove the initiator Met residue from newly synthesized proteins and are essential for cell growth. Three METAP genes (METAP1, METAP2 and MAP1D) have been identified in the human genome. METAP1 and METAP2 have different substrate specificity due to the differences in both size and shape of the active sites. METAP1 plays an important role in G(2)/M phase regulation of the cell cycle and may serve as a promising target for the discovery and development of new anticancer agents. Fumagillin, a natural compound, covalently modifies an active His residue of METAP2 and prevents the vascularization and metasis of tumors.

Source E. coli
Names Methionine Aminopeptidase, MAP, Peptidase M, map
Accession # P0AE18
Formulation Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 100mM NaCl, 50% Glycerol, pH 8.0
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGY PKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQ ESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVL KPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAII SHDELEHHHHHH

Copyright © 2003-2018

All Rights Reserved

Eton Bioscience, Inc.
5820 Oberlin Drive, Suite 108
San Diego, CA 92121
DNA Sequencing
Specialty DNA Sequencing
Direct Sequencing
Genomic Services
Fragment Analysis
Mammilian Cell Expression
Peptide Synthesis
Antibody Services
DNA Prep Service
Facebook LinkedIn Google Plus Twitter