Recombinant E.coli Mug

Eton Bio Recombinant E. coli G/U Mismatch-Specific DNA Glycosylase/Mug is produced with our E.coli expression system. The target protein is expressed with sequence (Met1-Arg168) of E.coli Mug.

Sku #Product NameProduct SizePriceQTY
3703310101 Recombinant E.coli Mug 10µg 10µg $210.00 USD
3703310501 Recombinant E.coli Mug 50µg 50µg $500.00 USD
3703315001 Recombinant E.coli Mug 500μg 500μg $1600.00 USD
3703310012 Recombinant E.coli Mug 1mg 1mg $2260.00 USD
 

Add to Cart

E. coli Mismatch Uracil DNA Glycosylase (Mug protein), also known as G/U mismatch-specific DNA glycosylase, is an 18 kDa constitutively expressed protein which belongs to the TDG/mug DNA glycosylase family. It has been proposed that the Mug protein excises 3,N4-ethenocytosine and removes the uracil base from mismatches in the order of U:G>U:A, although the biological role remains unclear. Uracil bases in DNA can arise from deamination of cytosine giving rise to increased spontaneous mutations. The enzyme Uracil-N-Glycosylase removes uracil from the DNA leaving an AP site. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and the mispaired base. The complementary strand guanine functions in substrate recognition. Required for DNA damage lesion repair in stationary-phase cells.

Source E. coli
Names G/U Mismatch-Specific DNA Glycosylase, Double-Strand-Specific Uracil Glycosylase, Mismatch-Specific Uracil DNA-Glycosylase, MUG, mug, ygjF
Accession # P0A9H1
Formulation Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 2.5mM β-ME, 1mM PMSF, 50% Glycerol, pH 8.0
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Amino Acid Sequence
MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPANRFWKVIYQAGFTDRQLKPQEAQHLLDYRCG VTKLVDRPTVQANEVSKQELHAGGRKLIEKIEDYQPQALAILGKQAYEQGFSQRGAQWGKQTLTI GSTQIWVLPNPSGLSRVSLEKLVEAYRELDQALVVRGRLEHHHHHH

Copyright © 2003-2018

All Rights Reserved

Eton Bioscience, Inc.
5820 Oberlin Drive, Suite 108
San Diego, CA 92121
DNA Sequencing
Specialty DNA Sequencing
Direct Sequencing
Genomic Services
Fragment Analysis
Mammilian Cell Expression
Peptide Synthesis
Antibody Services
DNA Prep Service
Facebook LinkedIn Google Plus Twitter