Recombinant E.coli Ecotin

Eton Bio Recombinant E. coli Ecotin is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Arg162) of E.coli Ecotin fused with a His tag at the C-terminus.

Sku #Product NameProduct SizePriceQTY
3701620101 Recombinant E.coli Ecotin 10μg 10μg $100.00 USD
3701620501 Recombinant E.coli Ecotin 50μg 50μg $160.00 USD
3701625001 Recombinant E.coli Ecotin 500μg 500μg $1110.00 USD
3701620012 Recombinant E.coli Ecotin 1mg 1mg $1560.00 USD
 

Add to Cart

Ecotins are dimeric periplasmic proteins from Escherichia coli and related Gram-negative bacteria that have been shown to be potent and general inhibitors of many trypsin-fold serine proteases of widely varying substrate specificity, which belong to MEROPS peptidase family S1. Ecotin protein inhibits chymotrypsin, trypsin, elastases, factor X, kallikrein as well as a variety of other proteases and has been characterized as an extremely potent anticoagulant and reversible tight-binding inhibitor of human factor Xa (FXa). The power of inhibition is not linked to a specific protease specificity. Immobilized ecotin has been used to affinity-purify recombinant trypsinogen, indicating that it may also be used to purify additional serine protease zymogens. Compared to other serine protease inhibitors such as members of the serpin family, the reactive site of ecotin is Met104 (P1). Phylogenetic analysis suggested that ecotin has an exogenous target, possibly neutrophil elastase. Ecotin from E. coli, Yersinia pestis, and Pseudomonas aeruginosa, all species that encounter the mammalian immune system, inhibit neutrophil elastase strongly while ecotin from the plant pathogen Pantoea citrea inhibits neutrophil elastase 1000-fold less potently. Ecotins all potently inhibit pancreatic digestive peptidases trypsin and chymotrypsin, while showing more variable inhibition of the blood peptidases Factor Xa, thrombin, and urokinase-type plasminogen activator. Ecotin is synthesized as a 162 amino acid precursor with a 20 amino acid signal peptide necessary to direct it to the periplasmic space. The mature protein (residues 21 - 162) is expressed and purified.

Source E. coli
Names Ecotin, eco, eti
Accession # P23827
Formulation Lyophilized from a 0.2 μM filtered solution of 20mM Tris-HCl, 300mM NaCl, pH 8.5
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/μg (1 IEU/μg).
Amino Acid Sequence
AESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLE GWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVW KAEEKIDNAVVRLEHHHHHH

Copyright © 2003-2018

All Rights Reserved

Eton Bioscience, Inc.
5820 Oberlin Drive, Suite 108
San Diego, CA 92121
DNA Sequencing
Specialty DNA Sequencing
Direct Sequencing
Genomic Services
Fragment Analysis
Mammilian Cell Expression
Peptide Synthesis
Antibody Services
DNA Prep Service
Facebook LinkedIn Google Plus Twitter